DNS Look Up Search



Order a complete name server report here.


Return to MAIN Index | Return to previous

DNS Server Prefix DNS Entries
15- 15-minutes-of-fame to wynncore
15 antisismico.org to cyevmb.com
150 150-230-ptr to johnfdeluca
150 blessed-empire.com to vseokino.info
150 bodystart.net to txwatkinstrans.com
150 comparrier to 48
150 freegracechurch to surinamegreen
150 gorczynski.biz to bentonelectricsystem.com
150 naturfotograf to uniquelyprague
151 151 to applestudio
152 hartetchi.com to altinorduorg.com
153 bata-bata to kiki-tai
153 consumerwiz to aching-rhythm
153 mikebasden.com to trucon.net
154 monnet.biz to imtsoft.com
155 155thpvi to itc-tokyo
156 galck.org to malaa3eb.com
156 pwst to eccenet
157 15771772 to pctecky
157 capitalgraphics to instrumentbrokers
157 gundr to babybc
158 acmsse to adampolnet
159 shiva-shakti to learning-connections
15a 15a to 15attractiveworld
15b 15bu to 15bu
15c 15channel to 15cv
15d 15dedicatedserver to skycitysex
15e 15e1dm to 15enhac
15f 15fatburningfoods to i2ya
15g 15gigs to 15gzcpii9ov
15h 15h15 to 15hostpleasantsite
15j 100mai to 15june09
15k 15kj to 15kqy5
15m 15mai to 15my-xr-online
15m sancler.net to qwik-sales.com
15n 4viewpornstars to 15nz
15o 15oka to 15or16
15p 15parsonscourt.com to buckscountybankruptcylegalhelp.info
15p buckscountybankruptcyreorganizationattorney.info to buckscountysuvcrashlawfirms.info
15p buckscountysuvcrashlawyer.info to caraccidentinjurylawfirmsphiladelphia.info
15p caraccidentinjurylawyerphiladelphia.info to delawarecountybikecrashlawyer.info
15p delawarecountybikeinjuryattorney.info to delawarecountyslipandfallaccidentlawfirm.info
15p delawarecountyslipandfallaccidentlawyer.info to montgomerycountyautocollisionattorneys.info
15p montgomerycountyautocollisionlawfirm.info to montgomerycountyfilingbankruptcy.info
15p montgomerycountyfireaccidentattorney.info to montgomerycountytruckingaccidentclaimslawfirm.info
15p montgomerycountytruckingaccidentclaimslawfirms.info to philadelphiaaccidentclaimslawyers.info
15p philadelphiaaccidentlawfirmreferral.info to philadelphiaelectrocutionlawfirm.info
15p philadelphiaelevatoraccidentattorney.info to philadelphiatruckcrashlawyer.info
15p philadelphiatruckcrashlawyers.info to tractortrailerinjuryaccidentlawyersphiladelphia.info
15p tractortrailerinjuryattorneysphiladelphia to thesexlove
15q 15q to 15qm
15r 15rb to interfind
15s arizona-movers to utahhousebuyer
15t educitus to scenariomaker
15u 15up-ro to 15up-ro
15v 15voip to 15voip
15w 15web to sexpasstech
15x 15x to 15xr

Return to MAIN Index | Return to previous



Copyright © 2003 - 2009 DNSlocator.com
Contact Us Click here
NOTE: Our service is only a guide as to how many domain names are hosted on any given nameserver. To determine the true size of an actual web hosting company, each name server associated with that particular host should be searched. Our search totals include .com, .net, .org, .biz, .us, .info and are limited to domain names that are considered (active) within each TLD zone.